PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof019058
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 147aa    MW: 16437.1 Da    PI: 9.5602
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Sof#S17355739PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-183689356
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               k++++++e +++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Sof019058 36 KKRRLSAEXVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 89
               456899***********************************************9 PP

2HD-ZIP_I/II127.84.7e-4135122188
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                  ekkrrls+e v++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+ y+aL+++ydal++e+++L +++++L 
    Sof019058  35 EKKRRLSAEXVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERGYAALRHSYDALSHEHDALPRDKDALL 122
                  69*********************************************************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.68E-192693IPR009057Homeodomain-like
PROSITE profilePS5007116.9253191IPR001356Homeobox domain
SMARTSM003893.8E-173495IPR001356Homeobox domain
PfamPF000466.4E-163689IPR001356Homeobox domain
CDDcd000866.77E-153692No hitNo description
Gene3DG3DSA:1.10.10.601.0E-193797IPR009057Homeodomain-like
PRINTSPR000313.7E-66271IPR000047Helix-turn-helix motif
PROSITE patternPS0002706689IPR017970Homeobox, conserved site
PRINTSPR000313.7E-67187IPR000047Helix-turn-helix motif
PfamPF021832.4E-1091122IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MTNPDDDGYG VVGMEADADA DEEMMACGGG GGGGEKKRRL SAEXVRALER SFEVENKLEP  60
ERKARLARDL GLQPRQVAVW FQNRRARWKT KQLERGYAAL RHSYDALSHE HDALPRDKDA  120
LLPRSRAQGK LGNKRHGNLT GQAEPRP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16066ERKARLA
28391RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.28530.0bud| inflorescence| leaf| meristem| root| seed| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957072.12e-66PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotQ6K4984e-66HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH374e-66HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLK3ZW403e-66K3ZW40_SETIT; Uncharacterized protein
STRINGSi030822m7e-66(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.17e-40homeobox protein 16